PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009605813.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 334aa    MW: 37453.1 Da    PI: 7.3716
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009605813.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.1e-52131411129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     lppGfrFhP+deel+++yL kkv+g++ + +   + evd++k+ePw++p+ +  + kewyf+s+rd+kyatg r+nrat sgyWkatgkd+++++
  XP_009605813.1  13 LPPGFRFHPRDEELICDYLMKKVAGSESDQQYPlLIEVDLNKSEPWEIPEVACVGGKEWYFYSQRDRKYATGLRTNRATVSGYWKATGKDRAIMR 107
                     79*************************777665699*************7666789*************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      kg+lvg++ktLvfy+grapkg+ktdWvmhe+rle
  XP_009605813.1 108 -KGSLVGMRKTLVFYQGRAPKGRKTDWVMHEFRLE 141
                     .999****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-613164IPR003441NAC domain
PROSITE profilePS5100558.37813163IPR003441NAC domain
PfamPF023651.7E-2614140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MSSSSLSMVE SKLPPGFRFH PRDEELICDY LMKKVAGSES DQQYPLLIEV DLNKSEPWEI  60
PEVACVGGKE WYFYSQRDRK YATGLRTNRA TVSGYWKATG KDRAIMRKGS LVGMRKTLVF  120
YQGRAPKGRK TDWVMHEFRL ETTSPHISSL KQEDWVLCRV FHKNKELLAV KQGTGSSIYH  180
EHDTISSSYL PPLMDPYITF DQTQPNNINI NTINMNELYY EQVPCFSIFN PNQTFSSHSH  240
HIPTAGATDA YGGLPADIGT YLNAAATSSS CDNKVIKAVL SHLNIMEGSH NNNNPARNTV  300
NVKAGGSPTS FGEGSSETSF LSEVGLTTMW NNHY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-55816412166NAC domain-containing protein 19
4dul_A7e-55816412166NAC domain-containing protein 19
1ut7_B7e-55816412166NO APICAL MERISTEM PROTEIN
1ut7_A7e-55816412166NO APICAL MERISTEM PROTEIN
1ut4_B7e-55816412166NO APICAL MERISTEM PROTEIN
1ut4_A7e-55816412166NO APICAL MERISTEM PROTEIN
3swp_D9e-55816415169NAC domain-containing protein 19
3swp_C9e-55816415169NAC domain-containing protein 19
3swp_B9e-55816415169NAC domain-containing protein 19
3swp_A9e-55816415169NAC domain-containing protein 19
3swm_D9e-55816415169NAC domain-containing protein 19
3swm_C9e-55816415169NAC domain-containing protein 19
3swm_B9e-55816415169NAC domain-containing protein 19
3swm_A9e-55816415169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1875392e-32AC187539.1 Solanum lycopersicum cv. Heinz 1706, chromosome 7 BAC clone C07HBa0179K09, complete sequence.
GenBankAC2103612e-32AC210361.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 7 clone C07HBa0215P04, complete sequence.
GenBankHG9754462e-32HG975446.1 Solanum pennellii chromosome ch07, complete genome.
GenBankHG9755192e-32HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605813.10.0PREDICTED: NAC domain-containing protein 21/22-like isoform X1
RefseqXP_016460548.10.0PREDICTED: NAC domain-containing protein 21/22-like isoform X1
SwissprotQ84TE61e-111NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM1C0290.0M1C029_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000569161e-180(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-109NAC domain containing protein 1